FGF12_HUMAN


Gene
Sequence
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Molecular Function F:growth factor activity;F:heparin binding;F:ion channel binding;F:sodium channel regulator activity;adult locomotory behavior;cardiac muscle cell action potential involved in contraction;cell-cell signaling;chemical synaptic transmission;fibroblast growth factor receptor signaling pathway;heart development;JNK cascade;negative regulation of cation channel activity;nervous system development;neuromuscular process;positive regulation of sodium ion transport;regulation of membrane depolarization;regulation of neuronal action potential;regulation of sodium ion transmembrane transport;regulation of sodium ion transmembrane transporter activity;regulation of voltage-gated sodium channel activity;signal transduction;
EMBL Protein ID AAB18913.1; AAB18786.3; BAG54181.1; BAG36423.1; BAG35414.1; EAW78084.1; AAH22524.1
UniProt FGF12_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / heparin-binding growth factors family
iProClass P61328
Pfam PF00167 
Google Search scholar keyword
PDBj 1Q1U 4JQ0
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P61328
CasaDB FGF12_HUMAN

Database