RTP1_HUMAN


Gene
Sequence
MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV
Molecular Function F:olfactory receptor binding;detection of chemical stimulus involved in sensory perception of bitter taste;protein insertion into membrane;protein targeting to membrane;
EMBL Protein ID AAH34744.4; AAH65202.2; AAT70680.1
UniProt RTP1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / TMEM7 family
iProClass P59025
Pfam PF13695 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P59025
CasaDB RTP1_HUMAN

Database