FAM3B_HUMAN


Gene
Sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Molecular Function F:cytokine activity;apoptotic process;glucose homeostasis;insulin secretion;
EMBL Protein ID CAC83974.1; AAL34495.1; AAK74134.1; AAM94280.1; AAQ88824.1; AAH57829.1
UniProt FAM3B_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / FAM3 family
iProClass P58499
Pfam PF15711 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P58499
CasaDB FAM3B_HUMAN

Database