K22E_HUMAN


Gene
Sequence
MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTAAENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADAEQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGDLSSNVTVSVTSSTISSNVASKAAFGGSGGRGSSSGGGYSSGSSSYGSGGRQSGSRGGSGGGGSISGGGYGSGGGSGGRYGSGGGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGGGYGSGGGGSSSVKGSSGEAFGSSVTFSFR
Molecular Function F:cytoskeletal protein binding;F:structural constituent of cytoskeleton;F:structural constituent of skin epidermis;cornification;epidermis development;intermediate filament organization;keratinization;keratinocyte activation;keratinocyte development;keratinocyte migration;keratinocyte proliferation;peptide cross-linking;positive regulation of epidermis development;
EMBL Protein ID AAC83410.1; AAB81946.1; -; AAH96294.1; AAH99643.1; AAH99644.1
UniProt K22E_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / intermediate filament family
iProClass P35908
Pfam PF00038  PF16208 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P35908
CasaDB K22E_HUMAN

Database