TNFL8_HUMAN


Gene
Sequence
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Molecular Function F:cytokine activity;F:signaling receptor binding;F:tumor necrosis factor receptor binding;CD8-positive, alpha-beta T cell differentiation;cell-cell signaling;defense response to Gram-positive bacterium;immune response;positive regulation of transcription by RNA polymerase II;regulation of T cell proliferation;tumor necrosis factor-mediated signaling pathway;
EMBL Protein ID AAA74594.1; AAB97877.1
UniProt TNFL8_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / tumor necrosis factor family
iProClass P32971  (Superfamily:tumour necrosis factor family protein, CD30 ligand type)
Pfam PF00229 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P32971
CasaDB TNFL8_HUMAN

Database