RBTN1_HUMAN


Gene
Sequence
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Molecular Function F:metal ion binding;negative regulation of transcription by RNA polymerase II;positive regulation of transcription by RNA polymerase II;regulation of hematopoietic stem cell differentiation;regulation of T cell homeostatic proliferation;
EMBL Protein ID AAA36819.1; CAC14587.1; -; AAH39512.1; AAH69673.1; AAH69752.1; AAH69793.1; AAH96056.1; AAH96057.1
UniProt RBTN1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P25800
Pfam PF00412 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P25800
CasaDB RBTN1_HUMAN

Database