ATF3_HUMAN


Gene
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Molecular Function F:DNA-binding transcription activator activity, RNA polymerase II-specific;F:DNA-binding transcription factor activity;F:DNA-binding transcription factor activity, RNA polymerase II-specific;F:DNA-binding transcription repressor activity, RNA polymerase II-specific;F:identical protein binding;F:protein heterodimerization activity;F:protein homodimerization activity;F:RNA polymerase II cis-regulatory region sequence-specific DNA binding;F:RNA polymerase II regulatory region sequence-specific DNA binding;F:transcription corepressor activity;F:transcription regulatory region DNA binding;F:transcription regulatory region sequence-specific DNA binding;cellular response to amino acid starvation;gluconeogenesis;negative regulation of ERK1 and ERK2 cascade;negative regulation of transcription by RNA polymerase II;PERK-mediated unfolded protein response;positive regulation of cell population proliferation;positive regulation of TRAIL-activated apoptotic signaling pathway;positive regulation of transcription by RNA polymerase II;positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress;regulation of transcription by RNA polymerase II;regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance;skeletal muscle cell differentiation;
EMBL Protein ID AAA20506.1; BAB84092.1; BAC00495.1; BAC00496.1; AAP93896.1; AAP35642.1; AAQ93358.1; BAG35834.1; -; CAG29330.1; EAW93385.1; EAW93386.1; EAW93387.1; EAW93388.1; AAH06322.1
UniProt ATF3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / bZIP family
iProClass P18847  (Superfamily:fos transforming protein)
Pfam PF00170 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P18847
CasaDB ATF3_HUMAN

Database