CL3L1_HUMAN


Gene
Sequence
MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Molecular Function F:CCR chemokine receptor binding;F:chemokine activity;cellular response to interferon-gamma;cellular response to interleukin-1;cellular response to tumor necrosis factor;chemokine-mediated signaling pathway;cytokine-mediated signaling pathway;eosinophil chemotaxis;G protein-coupled receptor signaling pathway;inflammatory response;lymphocyte chemotaxis;monocyte chemotaxis;negative regulation of cell population proliferation;neutrophil chemotaxis;positive regulation of ERK1 and ERK2 cascade;positive regulation of GTPase activity;
EMBL Protein ID CAA36397.1; AAA35859.1; BAA14173.1; AAP35429.1; AAH07783.1; AAH27888.1; AAI07711.1; AAI46915.1; AAI46920.1; AAI47009.1; AAI47014.1
UniProt CL3L1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / intercrine beta (chemokine CC) family
iProClass P16619  (Superfamily:small inducible chemokine, C/CC types)
Pfam PF00048 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P16619
CasaDB CL3L1_HUMAN

Database