HCLS1_HUMAN


Gene
Sequence
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE
Molecular Function F:actin filament binding;F:protein kinase binding;F:RNA polymerase II transcription factor binding;F:SH3 domain binding;actin filament polymerization;cellular response to cytokine stimulus;erythrocyte differentiation;intracellular signal transduction;negative regulation of leukocyte apoptotic process;negative regulation of transcription by RNA polymerase II;positive regulation of actin cytoskeleton reorganization;positive regulation of cell population proliferation;positive regulation of DNA-binding transcription factor activity;positive regulation of granulocyte differentiation;positive regulation of macrophage differentiation;positive regulation of peptidyl-serine phosphorylation;positive regulation of peptidyl-tyrosine phosphorylation;positive regulation of phosphatidylinositol 3-kinase signaling;positive regulation of protein import into nucleus;positive regulation of protein kinase B signaling;positive regulation of transcription by RNA polymerase II;positive regulation of tyrosine phosphorylation of STAT protein;regulation of actin filament polymerization;regulation of transcription, DNA-templated;response to hormone;
EMBL Protein ID CAA34651.1; AAP35470.1; BAG60831.1; BAG35617.1; CAG33075.1; -; AAH16758.1
UniProt HCLS1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P14317
Pfam PF02218  PF00018 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P14317
CasaDB HCLS1_HUMAN

Database