CD28_HUMAN


Gene
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Molecular Function F:coreceptor activity;F:identical protein binding;F:protease binding;F:protein kinase binding;F:SH3/SH2 adaptor activity;apoptotic signaling pathway;cell surface receptor signaling pathway;cytokine biosynthetic process;humoral immune response;immune system process;negative regulation of apoptotic process;negative regulation of gene expression;negative thymic T cell selection;positive regulation of alpha-beta T cell proliferation;positive regulation of gene expression;positive regulation of inflammatory response to antigenic stimulus;positive regulation of interleukin-10 production;positive regulation of interleukin-2 biosynthetic process;positive regulation of interleukin-4 production;positive regulation of isotype switching to IgG isotypes;positive regulation of mitotic nuclear division;positive regulation of phosphatidylinositol 3-kinase signaling;positive regulation of protein kinase B signaling;positive regulation of T cell proliferation;positive regulation of transcription by RNA polymerase II;positive regulation of translation;positive regulation of viral genome replication;regulation of defense response to virus by virus;regulation of regulatory T cell differentiation;regulatory T cell differentiation;T cell activation;T cell costimulation;T cell receptor signaling pathway;
EMBL Protein ID AAA60581.1; AAA51944.1; AAA51945.1; CAC29237.1; AAF33792.1; AAF33793.1; AAF33794.1; CAD57003.1; ABK41938.1; BAF85675.1; BAG36118.1; AAY24123.1; EAW70348.1; AAH93698.1; AAI12086.1; AAL40931.1
UniProt CD28_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P10747  (Superfamily:T-cell surface glycoprotein CD28)
Pfam PF15910 
Google Search scholar keyword
PDBj 1YJD 3WA4 5AUL 5GJH 5GJI 6O8D
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P10747
CasaDB CD28_HUMAN

Database