HVC33_HUMAN


Gene
Sequence
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
Molecular Function F:antigen binding;F:immunoglobulin receptor binding;B cell receptor signaling pathway;complement activation, classical pathway;defense response to bacterium;innate immune response;phagocytosis, engulfment;phagocytosis, recognition;positive regulation of B cell activation;
EMBL Protein ID AGI96763.1
UniProt HVC33_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P0DP02
Pfam PF07686 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P0DP02
CasaDB HVC33_HUMAN

Database