SG1C2_HUMAN


Gene
Sequence
MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA
Molecular Function
EMBL Protein ID -
UniProt SG1C2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / secretoglobin family
iProClass P0DMR2
Pfam PF01099 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P0DMR2
CasaDB SG1C2_HUMAN

Database