ANXA5_HUMAN


Gene
Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Molecular Function F:calcium ion binding;F:calcium-dependent phospholipid binding;F:phospholipase inhibitor activity;F:phospholipid binding;blood coagulation;negative regulation of apoptotic process;negative regulation of coagulation;platelet degranulation;response to organic substance;signal transduction;
EMBL Protein ID AAA35570.1; BAA00122.1; CAA30985.1; AAA52386.1; AAA36166.1; AAB59545.1; AAB40047.1; AAB60648.1; BAG35528.1; CAG38759.1; CAG46640.1; AAY40954.1; EAX05257.1; EAX05258.1; AAH01429.1; AAH04993.1; AAH12804.1; AAH12822.1; AAH18671.1
UniProt ANXA5_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / annexin family
iProClass P08758
Pfam PF00191 
Google Search scholar keyword

Database