PLEK_HUMAN


Gene
Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK
Molecular Function F:phosphatidylinositol-3,4-bisphosphate binding;F:protein homodimerization activity;F:protein kinase C binding;actin cytoskeleton reorganization;cell projection organization;cortical actin cytoskeleton organization;hematopoietic progenitor cell differentiation;integrin-mediated signaling pathway;negative regulation of calcium-mediated signaling;negative regulation of G protein-coupled receptor signaling pathway;negative regulation of inositol phosphate biosynthetic process;phosphatidylinositol metabolic process;phospholipase C-inhibiting G protein-coupled receptor signaling pathway;platelet aggregation;platelet degranulation;positive regulation of actin filament bundle assembly;positive regulation of actin filament depolymerization;positive regulation of inositol-polyphosphate 5-phosphatase activity;positive regulation of integrin activation;positive regulation of platelet activation;protein kinase C signaling;protein secretion by platelet;regulation of cell diameter;ruffle organization;thrombin-activated receptor signaling pathway;vesicle docking involved in exocytosis;
EMBL Protein ID CAA30564.1; CAG46853.1; CAG46876.1; BAG36495.1; AAX93121.1; EAW99876.1; AAH18549.1
UniProt PLEK_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P08567  (Superfamily:pleckstrin)
Pfam PF00610  PF00169 
Google Search scholar keyword

Database