FABPL_HUMAN


Gene
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Molecular Function F:antioxidant activity;F:bile acid binding;F:chromatin binding;F:drug binding;F:fatty acid binding;F:long-chain fatty acid transporter activity;F:phospholipid binding;cellular response to hydrogen peroxide;cellular response to hypoxia;intestinal absorption;negative regulation of apoptotic process;negative regulation of cysteine-type endopeptidase activity involved in apoptotic process;positive regulation of fatty acid beta-oxidation;positive regulation of hydrolase activity;regulation of lipid metabolic process;triglyceride catabolic process;
EMBL Protein ID AAA52419.1; AAA52418.1; AAH32801.1
UniProt FABPL_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / Fatty-acid binding protein (FABP) family
iProClass P07148  (Superfamily:lipid binding protein, FABP type)
Pfam PF14651 
Google Search scholar keyword

Database