TYSY_HUMAN


Gene
Sequence
MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Molecular Function F:drug binding;F:folic acid binding;F:protein homodimerization activity;F:sequence-specific mRNA binding;F:thymidylate synthase activity;F:translation repressor activity, mRNA regulatory element binding;aging;cartilage development;circadian rhythm;developmental growth;DNA biosynthetic process;dTMP biosynthetic process;dTTP biosynthetic process;intestinal epithelial cell maturation;liver regeneration;methylation;modulation by virus of host process;negative regulation of translation;nucleobase-containing small molecule interconversion;regulation of transcription involved in G1/S transition of mitotic cell cycle;response to cytokine;response to drug;response to ethanol;response to folic acid;response to glucocorticoid;response to organophosphorus;response to progesterone;response to toxic substance;response to vitamin A;tetrahydrofolate interconversion;uracil metabolic process;
EMBL Protein ID CAA26178.1; BAA00472.1; BAB83676.1; BAB83677.1; BAB93473.1; -; EAX01716.1; EAX01720.1; AAH02567.1; AAH13919.1; AAH83512.1; BAA00404.1
UniProt TYSY_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / thymidylate synthase family
iProClass P04818  (Superfamily:thymidylate synthase)
Pfam PF00303 
Google Search scholar keyword

Database