SODM_HUMAN


Gene
Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Molecular Function F:DNA binding;F:enzyme binding;F:identical protein binding;F:manganese ion binding;F:metal ion binding;F:oxygen binding;F:superoxide dismutase activity;acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure;age-dependent response to reactive oxygen species;cellular response to ethanol;cellular response to oxidative stress;detection of oxygen;erythrophore differentiation;glutathione metabolic process;heart development;hemopoiesis;hydrogen peroxide biosynthetic process;interleukin-12-mediated signaling pathway;intrinsic apoptotic signaling pathway in response to DNA damage;intrinsic apoptotic signaling pathway in response to oxidative stress;iron ion homeostasis;liver development;locomotory behavior;negative regulation of cell population proliferation;negative regulation of fat cell differentiation;negative regulation of fibroblast proliferation;negative regulation of neuron apoptotic process;negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway;negative regulation of vascular associated smooth muscle cell proliferation;neuron development;oxygen homeostasis;positive regulation of cell migration;positive regulation of nitric oxide biosynthetic process;positive regulation of vascular associated smooth muscle cell apoptotic process;positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching;post-embryonic development;protein homotetramerization;regulation of blood pressure;regulation of catalytic activity;regulation of mitochondrial membrane potential;regulation of transcription by RNA polymerase II;release of cytochrome c from mitochondria;removal of superoxide radicals;respiratory electron transport chain;response to activity;response to axon injury;response to cadmium ion;response to cold;response to drug;response to electrical stimulus;response to gamma radiation;response to hydrogen peroxide;response to hyperoxia;response to hypoxia;response to immobilization stress;response to isolation stress;response to L-ascorbic acid;response to lipopolysaccharide;response to magnetism;response to manganese ion;response to selenium ion;response to silicon dioxide;response to superoxide;response to zinc ion;superoxide anion generation;superoxide metabolic process;
EMBL Protein ID CAA42066.1; CAA68533.1; CAA68791.1; CAA30687.1; AAA36622.1; CAA33228.1; CAA32502.1; AAD14248.1; AAP35613.1; AAP03428.1; BAG53464.1; BAG59382.1; BAG65521.1; BAG35908.1; -; EAW47630.1; EAW47631.1; AAH12423.1
UniProt SODM_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / iron/manganese superoxide dismutase family
iProClass P04179  (Superfamily:superoxide dismutase, Mn/Fe specific)
Pfam PF02777  PF00081 
Google Search scholar keyword

Database