CD8A_HUMAN


Gene
Sequence
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Molecular Function F:coreceptor activity;F:MHC class I protein binding;F:MHC class I protein complex binding;antigen processing and presentation;cell surface receptor signaling pathway;cytotoxic T cell differentiation;immune response;regulation of immune response;T cell activation;T cell mediated immunity;transmembrane receptor protein tyrosine kinase signaling pathway;
EMBL Protein ID AAA79217.1; AAA79217.1; AAA79218.1; AAA61133.1; AAB04637.1; AAA59674.1; BAG61892.1; AAX88864.1; -; EAW99438.1; EAW99439.1; EAW99440.1
UniProt CD8A_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P01732  (Superfamily:T-cell surface glycoprotein CD8 alpha chain)
Pfam PF07686 
Google Search scholar keyword
PDBj 1AKJ 1CD8 1Q69 2HP4 3QZW
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P01732
CasaDB CD8A_HUMAN

Database