LV140_HUMAN


Gene
Sequence
MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG
Molecular Function F:antigen binding;complement activation;complement activation, classical pathway;Fc-epsilon receptor signaling pathway;Fc-gamma receptor signaling pathway involved in phagocytosis;immune response;immunoglobulin production;leukocyte migration;receptor-mediated endocytosis;regulation of complement activation;regulation of immune response;
EMBL Protein ID -
UniProt LV140_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass P01703  (Superfamily:immunoglobulin V region)
Pfam PF07686 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI P01703
CasaDB LV140_HUMAN

Database