MOCS3_HUMAN


Gene
Sequence
MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
Molecular Function F:ATP binding;F:metal ion binding;F:molybdopterin-synthase adenylyltransferase activity;F:molybdopterin-synthase sulfurtransferase activity;F:nucleotidyltransferase activity;F:sulfurtransferase activity;F:thiosulfate sulfurtransferase activity;F:URM1 activating enzyme activity;enzyme active site formation via cysteine modification to L-cysteine persulfide;Mo-molybdopterin cofactor biosynthetic process;molybdopterin cofactor biosynthetic process;protein modification by small protein conjugation;protein urmylation;tRNA thio-modification;tRNA wobble position uridine thiolation;tRNA wobble uridine modification;
EMBL Protein ID AAC72412.1; -; AAH15939.1
UniProt MOCS3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / HesA/MoeB/ThiF family
iProClass O95396
Pfam PF00581  PF00899 
Google Search scholar keyword
PDBj 3I2V
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O95396
CasaDB MOCS3_HUMAN

Database