ZN205_HUMAN


Gene
Sequence
MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT
Molecular Function F:DNA-binding transcription repressor activity, RNA polymerase II-specific;F:RNA polymerase II regulatory region sequence-specific DNA binding;F:zinc ion binding;negative regulation of transcription by RNA polymerase II;positive regulation of hydrogen peroxide biosynthetic process;positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway;regulation of transcription, DNA-templated;
EMBL Protein ID AAC70007.1; -; EAW85396.1; EAW85398.1; EAW85399.1; EAW85400.1; AAH02810.1
UniProt ZN205_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / krueppel C2H2-type zinc-finger protein family
iProClass O95201
Pfam PF01352  PF00096 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O95201
CasaDB ZN205_HUMAN

Database