ALX3_HUMAN


Gene
Sequence
MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPYLPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSIHGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT
Molecular Function F:DNA-binding transcription factor activity, RNA polymerase II-specific;F:RNA polymerase II regulatory region sequence-specific DNA binding;embryonic cranial skeleton morphogenesis;embryonic forelimb morphogenesis;embryonic hindlimb morphogenesis;pattern specification process;regulation of apoptotic process;
EMBL Protein ID AAD01417.2; AAD01418.1; -; EAW56430.1; AAI12008.1; AAI13429.1
UniProt ALX3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / paired homeobox family
iProClass O95076
Pfam PF00046 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O95076
CasaDB ALX3_HUMAN

Database