COQ9_HUMAN


Gene
Sequence
MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular Function F:lipid binding;F:protein homodimerization activity;mitochondrial electron transport, NADH to ubiquinone;ubiquinone biosynthetic process;
EMBL Protein ID AAF29004.1; BAC11621.1; BAF83316.1; AAC24313.1; EAW82928.1; AAH01478.2; AAH54340.2; AAH64946.1; CAB66818.2
UniProt COQ9_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / COQ9 family
iProClass O75208
Pfam PF08511 
Google Search scholar keyword
PDBj 4RHP 6AWL 6DEW
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O75208
CasaDB COQ9_HUMAN

Database