PFD1_HUMAN


Gene
Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
Molecular Function F:protein folding chaperone;F:unfolded protein binding;protein folding;
EMBL Protein ID CAA76759.1; BAD97114.1; BAG37749.1; EAW62071.1; AAH03620.1; AAH06202.1; AAH11869.1
UniProt PFD1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / prefoldin subunit beta family
iProClass O60925  (Superfamily:prefoldin subunit 1)
Pfam PF01920 
Google Search scholar keyword
PDBj 6NR8 6NR9 6NRB 6NRC 6NRD
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O60925
CasaDB PFD1_HUMAN

Database