ZN861_HUMAN


Gene
Sequence
MWLSTSPYRKGSQCGEAFSQIPGHNLNKKTPPGVKPPESHVCGEVGVGYPSTERHIRDRLGRKPCEYQECRQKAYTCKPCGNAFRFHHSFHIHERPHSGENLYEC
Molecular Function F:metal ion binding;
EMBL Protein ID AAC08455.1
UniProt ZN861_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass O60384
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O60384
CasaDB ZN861_HUMAN

Database