SYNC_HUMAN


Gene
Sequence
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Molecular Function F:asparagine-tRNA ligase activity;F:ATP binding;F:CCR3 chemokine receptor binding;F:nucleic acid binding;F:protein dimerization activity;asparaginyl-tRNA aminoacylation;cell migration;tRNA aminoacylation for protein translation;
EMBL Protein ID CAA04008.1; BAA34600.1; BAG57627.1; -; BAD96555.1; AAH01687.1
UniProt SYNC_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / class-II aminoacyl-tRNA synthetase family
iProClass O43776
Pfam PF00152  PF01336 
Google Search scholar keyword
PDBj 4ZYA 5XIX
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O43776
CasaDB SYNC_HUMAN

Database