PLPP2_HUMAN


Gene
Sequence
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
Molecular Function F:ceramide-1-phosphate phosphatase activity;F:lipid phosphatase activity;F:phosphatase activity;F:phosphatidate phosphatase activity;F:sphingosine-1-phosphate phosphatase activity;ceramide metabolic process;phospholipid dephosphorylation;phospholipid metabolic process;regulation of cell cycle G1/S phase transition;signal transduction;sphingolipid biosynthetic process;sphingosine metabolic process;
EMBL Protein ID AAC15968.1; AAC32104.1; AAC25666.1; AAP35667.1; -; AAH02806.1
UniProt PLPP2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / PA-phosphatase related phosphoesterase family
iProClass O43688  (Superfamily:lipid phosphate phosphatase)
Pfam PF01569 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O43688
CasaDB PLPP2_HUMAN

Database