PDCD5_HUMAN


Gene
Sequence
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Molecular Function F:acetyltransferase activator activity;F:beta-tubulin binding;F:DNA binding;F:heparin binding;apoptotic process;cellular response to transforming growth factor beta stimulus;negative regulation of cell population proliferation;negative regulation of chaperone-mediated protein folding;positive regulation of apoptotic process;positive regulation of cysteine-type endopeptidase activity involved in apoptotic process;positive regulation of gene expression;positive regulation of protein import into mitochondrial outer membrane;positive regulation of release of cytochrome c from mitochondria;
EMBL Protein ID AAD11579.1; AAP35340.1; BAG56975.1; CAG33215.1; -; AAH15519.1
UniProt PDCD5_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / PDCD5 family
iProClass O14737  (Superfamily:DNA-binding protein, TFAR19 type)
Pfam PF01984 
Google Search scholar keyword
PDBj 1YYB 2CRU 2K6B
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O14737
CasaDB PDCD5_HUMAN

Database