PRY_HUMAN


Gene
Sequence
MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRALGDICGHVHEED
Molecular Function
EMBL Protein ID AAC51835.2; AAN06674.1; EAW61212.1; AAI13549.1; AAI13551.1; AAI43894.1; AAI71757.1
UniProt PRY_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass O14603
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI O14603
CasaDB PRY_HUMAN

Database