ATOX1_HUMAN


Gene
Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Molecular Function F:ATPase binding;F:copper chaperone activity;F:copper ion binding;F:copper-dependent protein binding;F:metallochaperone activity;cellular copper ion homeostasis;copper ion export;copper ion transport;negative regulation of apoptotic process;response to oxidative stress;
EMBL Protein ID AAC51227.1; AAN84554.1; AAP88788.1; BAF85752.1; AAX81411.1; EAW61663.1; EAW61664.1; AAI12249.1; AAI12251.1
UniProt ATOX1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / ATX1 family
iProClass O00244
Pfam PF00403 
Google Search scholar keyword

Database