GGTL3_HUMAN


Gene
Sequence
MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
Molecular Function F:glutathione hydrolase activity;glutathione catabolic process;leukotriene D4 biosynthetic process;
EMBL Protein ID -
UniProt GGTL3_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / gamma-glutamyltransferase family
iProClass B5MD39
Pfam PF01019 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI B5MD39
CasaDB GGTL3_HUMAN

Database