LRR3C_HUMAN


Gene
Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLPLLLVIGTGGTVPSPQVPPRGCYVAKEAGERTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHNALAHLSGAAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPGTGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLMVAYLVHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Molecular Function
EMBL Protein ID -; EAW60623.1; -
UniProt LRR3C_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / LRRC3 family
iProClass A6NJW4
Pfam PF13855 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI A6NJW4
CasaDB LRR3C_HUMAN

Database