EFC10_HUMAN


Gene
Sequence
METSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEVNKRMKEI
Molecular Function F:calcium ion binding;
EMBL Protein ID -; -
UniProt EFC10_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass A6NFE3
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI A6NFE3
CasaDB EFC10_HUMAN

Database