C97D2_HUMAN


Gene
Sequence
MHGAPRLTFPCASEYLWHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRRK
Molecular Function
EMBL Protein ID -
UniProt C97D2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity / CFAP97 family
iProClass A0A1B0GU71
Pfam
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI A0A1B0GU71
CasaDB C97D2_HUMAN

Database