LBHD2_HUMAN


Gene
Sequence
MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG
Molecular Function
EMBL Protein ID -
UniProt LBHD2_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass A0A0U1RRK4
Pfam PF15317 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI A0A0U1RRK4
CasaDB LBHD2_HUMAN

Database