HV124_HUMAN


Gene
Sequence
MDCTWRILFLVAAATGTHAQVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
Molecular Function F:antigen binding;F:immunoglobulin receptor binding;B cell receptor signaling pathway;complement activation, classical pathway;defense response to bacterium;innate immune response;phagocytosis, engulfment;phagocytosis, recognition;positive regulation of B cell activation;
EMBL Protein ID -
UniProt HV124_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass A0A0C4DH33
Pfam PF07686 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI A0A0C4DH33
CasaDB HV124_HUMAN

Database