TVAZ1_HUMAN


Gene
Sequence
MRLVARVTVFLTFGTIIDAKTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV
Molecular Function adaptive immune response;
EMBL Protein ID -
UniProt TVAZ1_HUMAN from Homo sapiens (Human) / Seqs with 100%, 90%, 50% identity /
iProClass A0A087WT03
Pfam PF07686 
Google Search scholar keyword
PDBj
Info & Models GTOP SWISS-MODEL
CBRC workflows Annotation Comparative Modeling
PCI A0A087WT03
CasaDB TVAZ1_HUMAN

Database